IBM biomed.omics.bl.sm.ma-ted-458m + finetuned task checkpoints, served by CureCancerWithAI.
Every inference endpoint requires a bearer API key. Call the API server-side only — never expose the key to a browser.
Authorization: Bearer <YOUR_MAMMAL_API_KEY>
| Endpoint | Task | Input | Output |
|---|---|---|---|
POST /ppi | Protein–protein binding-affinity class | two amino-acid sequences | {"prediction": "..."} |
POST /dti | Drug–target binding affinity (pKd) | target AA sequence + drug SMILES | {"pKd": float} |
POST /clintox_tox | ClinTox clinical-trial toxicity | drug SMILES | {"pred": 0|1, "score": float} |
GET /health no key | Liveness + loaded models | — | {"status":"ok", ...} |
curl -X POST https://mammal.curecancerwithai.com/dti \
-H "Authorization: Bearer $MAMMAL_API_KEY" \
-H "Content-Type: application/json" \
-d '{"target_seq":"NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC","drug_seq":"CC(=O)NCCC1=CNc2c1cc(OC)cc2"}'
# -> {"pKd": 5.49}
curl -X POST https://mammal.curecancerwithai.com/clintox_tox \
-H "Authorization: Bearer $MAMMAL_API_KEY" \
-H "Content-Type: application/json" \
-d '{"smiles":"CC(CCl)OC(C)CCl"}'
# -> {"pred": 0, "score": 1.9e-05}
curl -X POST https://mammal.curecancerwithai.com/ppi \
-H "Authorization: Bearer $MAMMAL_API_KEY" \
-H "Content-Type: application/json" \
-d '{"protein_a":"MADQLTEEQ...","protein_b":"MSSKLLLAG..."}'
For interactive request building and the full schema, see /docs or /redoc.